DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and KLK8

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_653088.1 Gene:KLK8 / 11202 HGNCID:6369 Length:305 Species:Homo sapiens


Alignment Length:247 Identity:75/247 - (30%)
Similarity:116/247 - (46%) Gaps:17/247 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AGAS-GEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDL 84
            ||.| .::.|::.|....|...|:..:|.:.:  :..||..|:...||||||||.:    .:..:
Human    68 AGHSRAQEDKVLGGHECQPHSQPWQAALFQGQ--QLLCGGVLVGGNWVLTAAHCKK----PKYTV 126

  Fly    85 QYGSQMLARNS--SQVARVAAIFVHPGYEPED--KYVNDIALLQLAQSVALSKFVQPVRLPEPRQ 145
            :.|...|....  .|...|.....||.|...|  .:.:|:.||||....:|...|:|:.|.: ..
Human   127 RLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLAD-HC 190

  Fly   146 VTPGNASAVLAGWG-LNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQICAGLPEGGKGQC 209
            ..||....| :||| :.:........|...::::|...:|.:.:...:.|..:|||..:|. ..|
Human   191 TQPGQKCTV-SGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGA-DTC 253

  Fly   210 SGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNS 261
            .|||||||:..|:  ..||.||...||.|...|||:|.:..|:|||.:.:.|
Human   254 QGDSGGPLVCDGA--LQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGS 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 69/230 (30%)
Tryp_SPc 30..258 CDD:238113 70/232 (30%)
KLK8NP_653088.1 Tryp_SPc 77..297 CDD:214473 69/230 (30%)
Tryp_SPc 78..300 CDD:238113 70/232 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147443
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.