DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and LOC101730792

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_031762443.1 Gene:LOC101730792 / 101730792 -ID:- Length:146 Species:Xenopus tropicalis


Alignment Length:144 Identity:56/144 - (38%)
Similarity:76/144 - (52%) Gaps:10/144 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 ALLQLAQSVALSKFVQPVRLPEPRQVTP--GNASAVLAGWGLNAT-GGVVQQHLQKVKLQVFSDT 182
            |||.|.:....:.||..|.|| .:.|:|  |....| :|||..:| ||.....|:.|||.:....
 Frog     7 ALLPLNRPAFYNAFVSVVPLP-IQGVSPIEGRLCQV-SGWGFTSTIGGKPSDTLRSVKLPIVPMR 69

  Fly   183 EC--SERHQTYLHDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVF 245
            :|  |..:..::..:.||||...|||..|.|||||||:..|.  ..|:|||. ..||.|.:|||:
 Frog    70 KCNSSASYAGHITSNMICAGFITGGKDACQGDSGGPLVCDGK--VYGVVSWG-HSCANPKYPGVY 131

  Fly   246 TEVSAYVDWIVETV 259
            |.|:.:..||..|:
 Frog   132 TAVANFQRWIYRTI 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 53/138 (38%)
Tryp_SPc 30..258 CDD:238113 55/141 (39%)
LOC101730792XP_031762443.1 Tryp_SPc <7..141 CDD:214473 53/138 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.