DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Mcpt1l1

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001264597.1 Gene:Mcpt1l1 / 100360872 RGDID:2321286 Length:260 Species:Rattus norvegicus


Alignment Length:277 Identity:84/277 - (30%)
Similarity:128/277 - (46%) Gaps:34/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFYTATFLLAGASGEDGKIVNGTTAGPGEFPFVVSLR--RAKSGRHSCGATLLNPYWVLTAAHCV 74
            ||..|..|.:||..|:  |:.|..:.|...|::..|.  ..:..:.:||..|:...:|:|||||.
  Rat     5 LFLMALLLPSGAGAEE--IIGGVESRPHSRPYMAHLEITTERGYKATCGGFLVTRQFVMTAAHCK 67

  Fly    75 RGSSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVN--DIALLQLAQSVALSKFVQP 137
            ...:...|.:...|:  ..::.|..:|....|||.|   :.|.|  ||.||:|.:...::..|..
  Rat    68 GRETTVTLGVHDVSK--TESTQQKIKVEKQIVHPNY---NFYSNLHDIMLLKLQKKAKVTPAVDV 127

  Fly   138 VRLPEPRQ-VTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQICAGL 201
            :.||:|.. :.||..... ||||...........|::||.::. |.|..:.:..|.::.|:|.|.
  Rat   128 IPLPQPSDFLKPGKMCRA-AGWGQTGVTKPTSNTLREVKQRIM-DKEACKNYFHYNYNFQVCVGS 190

  Fly   202 PEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNSYSPPS 266
            |...:....|||||||:..|  ...||||:. :..|:|  |.|||.:|.||.||           
  Rat   191 PRKIRSAYKGDSGGPLVCAG--VAHGIVSYG-RGDAKP--PAVFTRISPYVPWI----------- 239

  Fly   267 SLWVGQLIVGRSPPSLS 283
                .::|.|:...|||
  Rat   240 ----NKVIKGKDLTSLS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 70/230 (30%)
Tryp_SPc 30..258 CDD:238113 72/232 (31%)
Mcpt1l1NP_001264597.1 Tryp_SPc 20..239 CDD:214473 70/232 (30%)
Tryp_SPc 21..242 CDD:238113 72/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.