DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and gzm3.4

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001108167.1 Gene:gzm3.4 / 100001210 ZFINID:ZDB-GENE-070912-136 Length:251 Species:Danio rerio


Alignment Length:236 Identity:71/236 - (30%)
Similarity:120/236 - (50%) Gaps:14/236 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQ 89
            |.:..||.|........|::.||:..:  :|:||..|:...:|||:|||.:.::  .|::..|:.
Zfish    20 GMESGIVGGREVKLHSRPYMASLQVQR--KHNCGGILIKEDYVLTSAHCWKDTT--NLEVVLGAH 80

  Fly    90 MLAR--NSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLP--EPRQVTPGN 150
            .:::  ||.|:.:|.....||.|:.:: :..||.||:|.....|:.||....||  ||..:.|..
Zfish    81 NISQRENSQQIIQVQKYIKHPNYQKKN-HSFDIMLLKLKTKAVLNHFVNITNLPKHEPSILAPVE 144

  Fly   151 ASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQICAGLPEGGKGQCSGDSGG 215
            .|  :||||:...|......|::|.||:.|::.|..:.|.|.:...:.....:|.|..|.||||.
Zfish   145 CS--IAGWGMQRPGEGASNVLREVNLQLESNSYCKSKWQVYFNSKNMVCTASDGKKAFCQGDSGS 207

  Fly   216 PLLLIGSDTQVGIVSWSI-KPCARPPFPGVFTEVSAYVDWI 255
            ||..  :....|:.:::. ..|....:|.|:.:|||::.||
Zfish   208 PLFC--NSELYGMAAYTYPNNCTFKEYPEVYMKVSAFLPWI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 68/230 (30%)
Tryp_SPc 30..258 CDD:238113 70/231 (30%)
gzm3.4NP_001108167.1 Tryp_SPc 25..249 CDD:238113 70/231 (30%)
Tryp_SPc 25..246 CDD:214473 68/229 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.