DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12661 and FAM136A

DIOPT Version :9

Sequence 1:NP_001259368.1 Gene:CG12661 / 31822 FlyBaseID:FBgn0030071 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001316681.1 Gene:FAM136A / 84908 HGNCID:25911 Length:245 Species:Homo sapiens


Alignment Length:102 Identity:31/102 - (30%)
Similarity:53/102 - (51%) Gaps:12/102 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 MHRCATACCADADANAEAVERCIDRCQIRLTRSRCFVQQGISDFENRLEKCIQQCRLNGSD---- 98
            |.||:.:||.|:.|:.:.|.:||:||.:.|.:::..|...:..|::||.:|...|.....|    
Human   139 MFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVTSELEKFQDRLARCTMHCNDKAKDSIDA 203

  Fly    99 --------YSLERCTSNCVDSHVGLLPEMFRAMRDTL 127
                    ..|:.|.:.|||.|:.|:|.|.:.|::.|
Human   204 GSKELQVKQQLDSCVTKCVDDHMHLIPTMTKKMKEAL 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12661NP_001259368.1 DUF842 11..121 CDD:283469 29/94 (31%)
FAM136ANP_001316681.1 DUF842 132..234 CDD:310419 29/94 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142850
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3377
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58561
OrthoDB 1 1.010 - - D1456794at2759
OrthoFinder 1 1.000 - - FOG0003130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21096
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.