DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12661 and AT1G05740

DIOPT Version :9

Sequence 1:NP_001259368.1 Gene:CG12661 / 31822 FlyBaseID:FBgn0030071 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_172065.1 Gene:AT1G05740 / 837081 AraportID:AT1G05740 Length:145 Species:Arabidopsis thaliana


Alignment Length:120 Identity:23/120 - (19%)
Similarity:49/120 - (40%) Gaps:14/120 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSLEEKRERVDNAILTAMEDLDRDYLRKLQIEMHRCATACCADADANAEAVERCIDRCQIRLTRS 70
            |.|...:|.:...:|.....:|.:    ||....:|:.. |.:.....|....|::.|::.:.:|
plant    29 SQLSPIQEHISFTLLIYAPLIDDE----LQQAYFKCSNE-CFEKRRKPEVTTNCVELCRVPVAKS 88

  Fly    71 RCFVQQGISDFENRLEKCIQQCR--------LNGSDYSLERCTSNCV-DSHVGLL 116
            :......::.|::|:.:.:..|:        ||.:.....:....|| |:...||
plant    89 QQQFDSDMAKFQDRMNRSLMVCQDKFEAAKLLNMNRIDAAKDMEGCVNDAAAALL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12661NP_001259368.1 DUF842 11..121 CDD:283469 21/115 (18%)
AT1G05740NP_172065.1 DUF842 19..139 CDD:283469 21/114 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3377
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1456794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.