DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12661 and AT1G05730

DIOPT Version :9

Sequence 1:NP_001259368.1 Gene:CG12661 / 31822 FlyBaseID:FBgn0030071 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_172064.2 Gene:AT1G05730 / 837080 AraportID:AT1G05730 Length:149 Species:Arabidopsis thaliana


Alignment Length:130 Identity:26/130 - (20%)
Similarity:57/130 - (43%) Gaps:15/130 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EEKRERVDNAILTAMEDLD--RDYLR-KLQIEMHRCATACCADADANAEAVERCIDRCQIRLTRS 70
            |..|.:::....||...|.  :|::. .||....:||.. |.|.:...|.:..|::.|.:.:..:
plant    14 ERIRRKLEEVNATAQSQLSPIQDHINFTLQQAYFKCAYE-CFDRNRKQEEIANCVEHCSVPVVNA 77

  Fly    71 RCFVQQGISDFENRLEKCIQQCR---------LNGSD--YSLERCTSNCVDSHVGLLPEMFRAMR 124
            :...:..:|.|:.|:.:.:..|:         .|..|  .::|.|.:..::..:..||.:.:.|:
plant    78 QQHFEGEMSQFQERMNRSLMVCQDKFEAAKLHKNRGDAAKAMESCVNTSIEDSLDTLPHIVQRMK 142

  Fly   125  124
            plant   143  142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12661NP_001259368.1 DUF842 11..121 CDD:283469 24/123 (20%)
AT1G05730NP_172064.2 DUF842 19..139 CDD:283469 23/120 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3658
eggNOG 1 0.900 - - E1_KOG3377
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I2496
OMA 1 1.010 - - QHG58561
OrthoDB 1 1.010 - - D1456794at2759
OrthoFinder 1 1.000 - - FOG0003130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21096
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.940

Return to query results.
Submit another query.