DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12661 and AT1G05730

DIOPT Version :10

Sequence 1:NP_572511.1 Gene:CG12661 / 31822 FlyBaseID:FBgn0030071 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_172064.2 Gene:AT1G05730 / 837080 AraportID:AT1G05730 Length:149 Species:Arabidopsis thaliana


Alignment Length:130 Identity:26/130 - (20%)
Similarity:57/130 - (43%) Gaps:15/130 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EEKRERVDNAILTAMEDLD--RDYLR-KLQIEMHRCATACCADADANAEAVERCIDRCQIRLTRS 70
            |..|.:::....||...|.  :|::. .||....:||.. |.|.:...|.:..|::.|.:.:..:
plant    14 ERIRRKLEEVNATAQSQLSPIQDHINFTLQQAYFKCAYE-CFDRNRKQEEIANCVEHCSVPVVNA 77

  Fly    71 RCFVQQGISDFENRLEKCIQQCR---------LNGSD--YSLERCTSNCVDSHVGLLPEMFRAMR 124
            :...:..:|.|:.|:.:.:..|:         .|..|  .::|.|.:..::..:..||.:.:.|:
plant    78 QQHFEGEMSQFQERMNRSLMVCQDKFEAAKLHKNRGDAAKAMESCVNTSIEDSLDTLPHIVQRMK 142

  Fly   125  124
            plant   143  142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12661NP_572511.1 DUF842 11..121 CDD:461747 24/123 (20%)
AT1G05730NP_172064.2 DUF842 19..139 CDD:461747 23/120 (19%)

Return to query results.
Submit another query.