DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12661 and AT2G31725

DIOPT Version :9

Sequence 1:NP_001259368.1 Gene:CG12661 / 31822 FlyBaseID:FBgn0030071 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_565729.1 Gene:AT2G31725 / 817729 AraportID:AT2G31725 Length:149 Species:Arabidopsis thaliana


Alignment Length:133 Identity:27/133 - (20%)
Similarity:58/133 - (43%) Gaps:22/133 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LEEKRERVDNAILTAMEDLDRDYLR-KLQIEMHRCATACCADADANAEAVERCIDRCQIRLTRSR 71
            |..|.|.|:.|..|.:..: :|::. .||....:||.. |.|.....|.:..|::.|.:.:.:|:
plant    16 LRRKLEEVNVAAQTQLSPI-QDHINFTLQQAYFKCAYE-CFDRRRKQEEISNCVEHCSVPVVKSQ 78

  Fly    72 CFVQQGISDFENRLEKCIQQCR---------------LNGSDYSLERCTSNCVDSHVGLLPEMFR 121
            .:.:..::.|:.||.:.:..|:               :|    .:|.|....::.::..||.:.:
plant    79 QYFENEMAQFQERLNRSLVVCQDKFEASKLQKIRPEAVN----EMESCVHKSIEENLNTLPHIVQ 139

  Fly   122 AMR 124
            .|:
plant   140 RMK 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12661NP_001259368.1 DUF842 11..121 CDD:283469 25/125 (20%)
AT2G31725NP_565729.1 DUF842 19..139 CDD:399073 25/125 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3658
eggNOG 1 0.900 - - E1_KOG3377
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I2496
OMA 1 1.010 - - QHG58561
OrthoDB 1 1.010 - - D1456794at2759
OrthoFinder 1 1.000 - - FOG0003130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21096
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.940

Return to query results.
Submit another query.