DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12661 and Fam136a

DIOPT Version :9

Sequence 1:NP_001259368.1 Gene:CG12661 / 31822 FlyBaseID:FBgn0030071 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_079867.1 Gene:Fam136a / 66488 MGIID:1913738 Length:138 Species:Mus musculus


Alignment Length:131 Identity:39/131 - (29%)
Similarity:69/131 - (52%) Gaps:12/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EEKRERVDNAILTAMEDLDRDYLRKLQIEMHRCATACCADADANAEAVERCIDRCQIRLTRSRCF 73
            |.::.||..|:...::.::|:.:||:|..|.||:..||.|..|:.:.|.:||:||...|.:::..
Mouse     3 EVQQLRVQEAVDAMVKSVERENIRKMQGLMFRCSANCCEDTQASMQQVHQCIERCHAPLAQAQAL 67

  Fly    74 VQQGISDFENRLEKCIQQCRLNGSD------------YSLERCTSNCVDSHVGLLPEMFRAMRDT 126
            |...:..|::||.:|...|.....|            ..|:.|.:.|||.|:.|:|.|.:.|:::
Mouse    68 VTSELERFQDRLARCTMHCNDKAKDSMDAGTKELQVKRQLDSCVTKCVDDHMHLIPTMTKKMKES 132

  Fly   127 L 127
            |
Mouse   133 L 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12661NP_001259368.1 DUF842 11..121 CDD:283469 36/121 (30%)
Fam136aNP_079867.1 DUF842 5..127 CDD:283469 36/121 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832974
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3377
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58561
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21096
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.