DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12661 and CG5327

DIOPT Version :9

Sequence 1:NP_001259368.1 Gene:CG12661 / 31822 FlyBaseID:FBgn0030071 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_725807.1 Gene:CG5327 / 37138 FlyBaseID:FBgn0034363 Length:149 Species:Drosophila melanogaster


Alignment Length:138 Identity:45/138 - (32%)
Similarity:83/138 - (60%) Gaps:15/138 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LEEKRERVDNAILTAMEDLDRDYLRKLQIEMHRCATACCADADANAEAVERCIDRCQIRLTRSRC 72
            :|::::|::.||...:||:.|.:||::|..|||||..||.|.....|:|:.||::|...|..::.
  Fly     2 VEQQKKRLEGAISEMIEDMYRTHLRRMQSTMHRCAARCCDDDRGTLESVQNCIEKCAGPLMDAQD 66

  Fly    73 FVQQGISDFENRLEKCIQQCR---------------LNGSDYSLERCTSNCVDSHVGLLPEMFRA 122
            |:|..:..|:|||:.|::.|.               ::.|.:..|.||:||||.::.|:|.:.::
  Fly    67 FLQHELGQFQNRLQNCVRDCNSDARSQMPSNPSDRDMSRSQHMFESCTNNCVDKYINLIPGLLKS 131

  Fly   123 MRDTLEKG 130
            ::.||::|
  Fly   132 IKQTLDRG 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12661NP_001259368.1 DUF842 11..121 CDD:283469 41/124 (33%)
CG5327NP_725807.1 DUF842 5..130 CDD:283469 41/124 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440464
Domainoid 1 1.000 64 1.000 Domainoid score I3658
eggNOG 1 0.900 - - E1_KOG3377
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I2496
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1456794at2759
OrthoFinder 1 1.000 - - FOG0003130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21096
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.