DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12661 and CG5327

DIOPT Version :10

Sequence 1:NP_572511.1 Gene:CG12661 / 31822 FlyBaseID:FBgn0030071 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_725807.1 Gene:CG5327 / 37138 FlyBaseID:FBgn0034363 Length:149 Species:Drosophila melanogaster


Alignment Length:138 Identity:45/138 - (32%)
Similarity:83/138 - (60%) Gaps:15/138 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LEEKRERVDNAILTAMEDLDRDYLRKLQIEMHRCATACCADADANAEAVERCIDRCQIRLTRSRC 72
            :|::::|::.||...:||:.|.:||::|..|||||..||.|.....|:|:.||::|...|..::.
  Fly     2 VEQQKKRLEGAISEMIEDMYRTHLRRMQSTMHRCAARCCDDDRGTLESVQNCIEKCAGPLMDAQD 66

  Fly    73 FVQQGISDFENRLEKCIQQCR---------------LNGSDYSLERCTSNCVDSHVGLLPEMFRA 122
            |:|..:..|:|||:.|::.|.               ::.|.:..|.||:||||.::.|:|.:.::
  Fly    67 FLQHELGQFQNRLQNCVRDCNSDARSQMPSNPSDRDMSRSQHMFESCTNNCVDKYINLIPGLLKS 131

  Fly   123 MRDTLEKG 130
            ::.||::|
  Fly   132 IKQTLDRG 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12661NP_572511.1 DUF842 11..121 CDD:461747 41/124 (33%)
CG5327NP_725807.1 DUF842 5..130 CDD:461747 41/124 (33%)

Return to query results.
Submit another query.