DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12661 and CG5323

DIOPT Version :10

Sequence 1:NP_572511.1 Gene:CG12661 / 31822 FlyBaseID:FBgn0030071 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_611346.1 Gene:CG5323 / 37137 FlyBaseID:FBgn0034362 Length:146 Species:Drosophila melanogaster


Alignment Length:141 Identity:49/141 - (34%)
Similarity:84/141 - (59%) Gaps:21/141 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LEEKRERVDNAILTAMEDLDRDYLRKLQIEMHRCATACCADADANAEAVERCIDRCQIRLTRSRC 72
            ::::|::::.|:...::|:|:.:|||:|.|||.||..||.|..::.::|:||:|||...:||::.
  Fly     2 IQQQRQKIEAAVTEMIDDMDKTHLRKMQNEMHLCAAKCCQDGTSSVDSVQRCVDRCSAPMTRAQN 66

  Fly    73 FVQQGISDFENRLEKCIQQCRLNGSDYSL------------------ERCTSNCVDSHVGLLPEM 119
            :||..:.:|:.||::|:.||   ..|..:                  |||...|||.||||:|.|
  Fly    67 YVQHELGEFQGRLQRCVMQC---NDDVKVKMPPSPNEDQIAKYTDQFERCAIQCVDKHVGLIPGM 128

  Fly   120 FRAMRDTLEKG 130
            .:.|:..|.||
  Fly   129 MKTMKAVLSKG 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12661NP_572511.1 DUF842 11..121 CDD:461747 45/127 (35%)
CG5323NP_611346.1 DUF842 5..130 CDD:461747 45/127 (35%)

Return to query results.
Submit another query.