DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12661 and ZK637.2

DIOPT Version :9

Sequence 1:NP_001259368.1 Gene:CG12661 / 31822 FlyBaseID:FBgn0030071 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001379046.1 Gene:ZK637.2 / 176252 WormBaseID:WBGene00014022 Length:143 Species:Caenorhabditis elegans


Alignment Length:131 Identity:36/131 - (27%)
Similarity:68/131 - (51%) Gaps:18/131 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NSSLEEKRERVDNAILTAMEDLDRDYLRKLQIEMHRCATACCADADANAEAVERCIDRCQIRLTR 69
            ||::|..:.:|..|:...::|||:.|||.:|..|.:|:..||.:.....:|||.|::.|...:.:
 Worm     3 NSTMEATQMKVKLAVDEMIDDLDKTYLRDMQKSMFQCSARCCDNKKTTRDAVENCVESCNDGMKK 67

  Fly    70 SRCFVQQGISDFENRLEKCIQQC-----RLNGSD---YS----------LERCTSNCVDSHVGLL 116
            ::.::::.:...:::|.:|...|     :..|.|   ||          |:.|.|.|.|.|:.|:
 Worm    68 AQGYLEKELGGLQDQLSRCAMTCYDKLVQQFGPDVNKYSESQKLSFNEKLDSCVSVCADDHIKLI 132

  Fly   117 P 117
            |
 Worm   133 P 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12661NP_001259368.1 DUF842 11..121 CDD:283469 33/125 (26%)
ZK637.2NP_001379046.1 DUF842 10..137 CDD:399073 33/124 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157333
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3377
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58561
OrthoDB 1 1.010 - - D1456794at2759
OrthoFinder 1 1.000 - - FOG0003130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21096
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.