DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32797 and PNRC2

DIOPT Version :9

Sequence 1:	NP_726810.1	Gene:	CG32797 / 318215	FlyBaseID:	FBgn0052797	Length:	202	Species:	Drosophila melanogaster
Sequence 2:	NP_060231.1	Gene:	PNRC2 / 55629	HGNCID:	23158	Length:	139	Species:	Homo sapiens

Alignment Length:	139	Identity:	34/139 - (24%)
Similarity:	53/139 - (38%)	Gaps:	35/139 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly     4 ASASKESTKRSNQRQRQLQSQYQSTASKFKHQKSQQQQQGSSKGGGNNKRRNRAGRWHQGARQLR 68
            |..|:..:|...|..|| :::.|::..|..|:|.:       :|.|.|   :.|..|.
Human    11 APQSRNVSKNQQQLNRQ-KTKEQNSQMKIVHKKKE-------RGHGYN---SSAAAWQ------- 57

  Fly    69 QSPVTIWNGGFCPGIVRGSSRKQRKSSWLGGKISAQHQIQQQHPRIPSSLTHFAVSKCFLAPPPT 133
                .:.|||.........|   ..||..|.::..:.|..|          ::|.:|....|.|:
Human    58 ----AMQNGGKNKNFPNNQS---WNSSLSGPRLLFKSQANQ----------NYAGAKFSEPPSPS 105

  Fly   134 ALPNPPEHW 142
            .||.||.||
Human   106 VLPKPPSHW 114

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32797	NP_726810.1	None
PNRC2	NP_060231.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..51		13/50 (26%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	61..80		6/21 (29%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	89..110		7/30 (23%)
		PNRC	91..137	CDD:317732	11/34 (32%)
		SH3-binding	99..105		1/5 (20%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR15405
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.100