DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32797 and PNRC1

DIOPT Version :9

Sequence 1:	NP_726810.1	Gene:	CG32797 / 318215	FlyBaseID:	FBgn0052797	Length:	202	Species:	Drosophila melanogaster
Sequence 2:	NP_006804.1	Gene:	PNRC1 / 10957	HGNCID:	17278	Length:	327	Species:	Homo sapiens

Alignment Length:	118	Identity:	26/118 - (22%)
Similarity:	48/118 - (40%)	Gaps:	21/118 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly    45 SKGGGNNKRRNRAGRWHQGARQLRQSPVTIWNGGFCPGIVRGSSRKQRKSSWLGGKISAQHQIQQ 109
            ||.|.:.|.....|:...|.....|..:......:...:.:.:|.|:.::::....:|:. :||:
Human   184 SKMGKSEKIALPHGQLVHGIHLYEQPKINRQKSKYNLPLTKITSAKRNENNFWQDSVSSD-RIQK 247

  Fly   110 Q--------------HPRIPSSLT------HFAVSKCFLAPPPTALPNPPEHW 142
            |              |.:..:.||      ::|.:|....|.|:.||.||.||
Human   248 QEKKPFKNTENIKNSHLKKSAFLTEVSQKENYAGAKFSDPPSPSVLPKPPSHW 300

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32797	NP_726810.1	None
PNRC1	NP_006804.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	66..175
		Nuclear localization signal. /evidence=ECO:0000269\|PubMed:10894149	94..101
		PNRC	277..325	CDD:292009	10/24 (42%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	280..300		8/19 (42%)
		SH3-binding	285..291		1/5 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR15405
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.100