DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32797 and Pnrc1

DIOPT Version :9

Sequence 1:NP_726810.1 Gene:CG32797 / 318215 FlyBaseID:FBgn0052797 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001028397.2 Gene:Pnrc1 / 108767 MGIID:1917838 Length:297 Species:Mus musculus


Alignment Length:96 Identity:23/96 - (23%)
Similarity:34/96 - (35%) Gaps:30/96 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RRNRAGRWHQGARQLRQSPVTIWNGGFCPGIVRGSSRKQRKSSWLGGKISAQHQIQQQHPRIPSS 117
            :||.:..|...|...|.                   :||.|.|:     .....|:..|.:..:.
Mouse   199 KRNESDFWQDSASSDRM-------------------QKQEKKSF-----KNTENIKSNHLKKSAF 239

  Fly   118 LT------HFAVSKCFLAPPPTALPNPPEHW 142
            ||      ::|.:|....|.|:.||.||.||
Mouse   240 LTEVSQKENYAGAKFSDPPSPSVLPKPPSHW 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32797NP_726810.1 None
Pnrc1NP_001028397.2 PNRC 247..295 CDD:292009 10/24 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15405
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.