DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32797 and Pnrc2

DIOPT Version :9

Sequence 1:NP_726810.1 Gene:CG32797 / 318215 FlyBaseID:FBgn0052797 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001096830.1 Gene:Pnrc2 / 100125373 RGDID:1642418 Length:134 Species:Rattus norvegicus


Alignment Length:136 Identity:30/136 - (22%)
Similarity:50/136 - (36%) Gaps:40/136 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SKESTKRSNQRQRQLQSQYQSTASKFKHQKSQQQQQGSSKGGGNNKRRNRAGRWHQGARQLRQSP 71
            |:.::|...|..|| :::.|::..|..|:|.:       :|.|.|                   |
  Rat    14 SRNASKNQQQHNRQ-KTKDQNSQMKIVHKKKE-------RGHGYN-------------------P 51

  Fly    72 VTIWNGGFCPGIVRGSSRKQRKSSWLGGKISAQHQIQQQHPRIPSSLTHFAVSKCFLAPPPTALP 136
            ..:.|||....:       ...|:|.....|.....:.|      :..::|.:|....|.|:.||
  Rat    52 SAVQNGGKTKSL-------SNNSNWNASLSSPSLLFKSQ------ASQNYAGAKFSEPPSPSVLP 103

  Fly   137 NPPEHW 142
            .||.||
  Rat   104 KPPSHW 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32797NP_726810.1 None
Pnrc2NP_001096830.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..74 18/93 (19%)
PNRC 88..106 CDD:405947 6/17 (35%)
SH3-binding 94..100 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15405
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.