DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk8 and Y57G11C.44

DIOPT Version :9

Sequence 1:NP_001036260.3 Gene:ppk8 / 318213 FlyBaseID:FBgn0052792 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_001255829.1 Gene:Y57G11C.44 / 3565567 WormBaseID:WBGene00013333 Length:155 Species:Caenorhabditis elegans


Alignment Length:106 Identity:22/106 - (20%)
Similarity:47/106 - (44%) Gaps:9/106 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SQQKRSRPQHLQITLSTWRRILSRNTDEFCRNTTIHGLKYINNSKLRSSDRLFFGIALLVVLSLA 78
            :.|.:.:|    :..:.|.:..|. ..|:..:.:.||:.::..| |.....|.:...|::...|.
 Worm    34 NDQWKDKP----VDETRWSKTKSA-VHEWGLSCSWHGIPHMAQS-LSWPTILLWTTLLIISAVLF 92

  Fly    79 IYLIQDAFDKWNTNPVIVGIDPELTSIANEPFPAVTICNLN 119
            :|||.....::.:...:|.::   ..:....||::|.||.|
 Worm    93 VYLITVTVRQYFSFQKLVNLN---IGMVESNFPSITFCNTN 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk8NP_001036260.3 ASC 42..508 CDD:279230 17/78 (22%)
Y57G11C.44NP_001255829.1 ASC 60..>142 CDD:279230 17/75 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162352
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.