DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tlk and RTK1

DIOPT Version :9

Sequence 1:NP_001138153.1 Gene:Tlk / 318206 FlyBaseID:FBgn0283657 Length:1489 Species:Drosophila melanogaster
Sequence 2:NP_010259.1 Gene:RTK1 / 851536 SGDID:S000002183 Length:620 Species:Saccharomyces cerevisiae


Alignment Length:311 Identity:69/311 - (22%)
Similarity:126/311 - (40%) Gaps:69/311 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1156 LGKGGFSEVHKAFDLKEQRYVACKV----HQLNKDWKEDKKANYIKHALREYNIHKALDHPRVVK 1216
            ||:|....| ...:..:.:..|||:    |..|:...:.:.|||.|....|:.|...|.|..:|:
Yeast   308 LGEGASGSV-SVVERTDGKLFACKMFRKPHLNNEGTNQSQLANYSKKVTTEFCIGSTLHHENIVE 371

  Fly  1217 LYDVFEIDANSFCTVLEYCDGHDLDFY-LKQHKTIPEREARSIIMQVVSALKYLNEIKPPVIHYD 1280
            ..|:. .:.:::..|:||.   ..||: |.....:.:.|......|:...:.||:.:  .:.|.|
Yeast   372 TLDML-TEGDTYLLVMEYA---PYDFFNLVMSNLMTQDEVNCYFKQLCHGVNYLHSM--GLAHRD 430

  Fly  1281 LKPGNILLTEGNVCGEIKITDFGLSKVMD---DENYNPDHGMDLTSQGAGTYWYLPPECFVVGKN 1342
            ||..|.::|:.   |.:|:.|||.:.|..   ::.....||:      .|:..||.||.......
Yeast   431 LKLDNCVVTKD---GILKLIDFGSAVVFQYPYEDTIVKSHGI------VGSDPYLAPELLKQTSY 486

  Fly  1343 PPKISSKVDVWSVGVIFYQCLYGKKPFGHNQSQATILEENTILKATEVQFSNKPTVSNEAKSFIR 1407
            .|:::   ||||:.:|||..:..:.|:                ||.:..|::....:.|      
Yeast   487 DPRVA---DVWSIAIIFYCMVLKRFPW----------------KAPKKSFNSFRLFTEE------ 526

  Fly  1408 GCLAYRKEDRMDVFALARHEYIQPP------IPKHGRGSLNQQQQAQQQQQ 1452
                  .||..|:        ::.|      :|:|.|..:.:....:.:|:
Yeast   527 ------PEDEDDI--------VRGPNKILRLLPRHSRTIIGRMLALEPKQR 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TlkNP_001138153.1 S_TKc 1161..1429 CDD:214567 61/275 (22%)
STKc_TLK 1161..1428 CDD:270892 61/274 (22%)
RTK1NP_010259.1 STKc_HAL4_like 308..575 CDD:270896 69/311 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I1178
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.