DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tlk and pcmtd1

DIOPT Version :9

Sequence 1:NP_001138153.1 Gene:Tlk / 318206 FlyBaseID:FBgn0283657 Length:1489 Species:Drosophila melanogaster
Sequence 2:NP_001011375.1 Gene:pcmtd1 / 496842 XenbaseID:XB-GENE-5750991 Length:137 Species:Xenopus tropicalis


Alignment Length:131 Identity:31/131 - (23%)
Similarity:45/131 - (34%) Gaps:35/131 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1236 DGHDLDFYLKQHKTIPEREARSIIMQVVSALKYLNEIKPPVIHYDL--KPGNILLTEGNVCGEIK 1298
            |..||...||:.:.|...........:.....||...:... :.||  |.|||.|:...:     
 Frog    10 DNDDLIDNLKEAQYIRTERVEQAFRAIDRGEYYLEGYRDNA-YKDLAWKHGNIHLSAPCI----- 68

  Fly  1299 ITDFGLSKVMDDENYNPDHGMDLTSQGAGTYWYLPPECFVVGKNPPKISSKVDVWSVGVIFYQCL 1363
                 .|:||:.....|  |:...:.|:|| .||..                   .||:|..:||
 Frog    69 -----YSEVMEALKLQP--GLSFLNLGSGT-GYLST-------------------MVGLILGKCL 106

  Fly  1364 Y 1364
            |
 Frog   107 Y 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TlkNP_001138153.1 S_TKc 1161..1429 CDD:214567 31/131 (24%)
STKc_TLK 1161..1428 CDD:270892 31/131 (24%)
pcmtd1NP_001011375.1 PCMT 11..>99 CDD:332916 24/120 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 462 1.000 Domainoid score I475
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001851
OrthoInspector 1 1.000 - - otm47518
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1213
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.