DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HNRNPAB and Hrb87F

DIOPT Version :9

Sequence 1:NP_112556.2 Gene:HNRNPAB / 3182 HGNCID:5034 Length:332 Species:Homo sapiens
Sequence 2:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster


Alignment Length:338 Identity:114/338 - (33%)
Similarity:169/338 - (50%) Gaps:63/338 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    51 NQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGF 115
            |.|..:|::|.   ..|...|:|:|||.:.|:...||.:|.|:|.:||..:..||.|.|||||||
  Fly     8 NGNYDDGEEIT---EPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGF 69

Human   116 ILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKK--DP-----VKKIFVGGLNPEATEEKIREY 173
            |.:..:..::...:.:.|::|||.::||:|:..::  .|     |||:|||||..:..||.:|||
  Fly    70 ITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREY 134

Human   174 FGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQ 238
            |.:||:|.::.:..|....|:|||.||.|.:.:||.|::.:|.|::.....::|.|..|:...:|
  Fly   135 FKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMDRQ 199

Human   239 --------------------QYGSGGRGNRNR----GNRGSGGGGGG------------GGQSQS 267
                                ..|.||.|.:||    ||.|..|||||            ||.|..
  Fly   200 GGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGG 264

Human   268 WNQ----GYGNYWNQG---YGYQQGYGPGYGGYDYSPY-------GYYGYGPGYDYSQGSTNYGK 318
            |||    |.|.:.|||   .|:..|.|.||||.:.:..       |..|.|.|.:|.|   :||.
  Fly   265 WNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQ---SYGG 326

Human   319 SQRRGGHQNNYKP 331
            ..:|..:..|.:|
  Fly   327 GPQRNSNFGNNRP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HNRNPABNP_112556.2 CBFNT 1..70 CDD:311868 5/18 (28%)
RRM1_hnRNPAB 66..145 CDD:410151 31/78 (40%)
RRM2_hnRNPAB 150..229 CDD:409997 32/85 (38%)
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 31/76 (41%)
RRM_SF 116..188 CDD:302621 28/71 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.