Sequence 1: | NP_112556.2 | Gene: | HNRNPAB / 3182 | HGNCID: | 5034 | Length: | 332 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014671.1 | Gene: | Rb97D / 43231 | FlyBaseID: | FBgn0004903 | Length: | 471 | Species: | Drosophila melanogaster |
Alignment Length: | 317 | Identity: | 93/317 - (29%) |
---|---|---|---|
Similarity: | 145/317 - (45%) | Gaps: | 79/317 - (24%) |
- Green bases have known domain annotations that are detailed below.
Human 58 DQINASKNEED-------AGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGF 115
Human 116 ILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKD-------PVKKIFVGGLNPEATEEKIREY 173
Human 174 FGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKEVY--- 235
Human 236 QQQQYGSGGRGNR-----NRGNRGSGGG---GGGGGQSQSW------NQGYG------------- 273
Human 274 -----NYWN------QGYGYQQ-------GYGPGYGGYDYSPYGYYGYG------PG 306 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HNRNPAB | NP_112556.2 | CBFNT | 1..70 | CDD:311868 | 5/18 (28%) |
RRM1_hnRNPAB | 66..145 | CDD:410151 | 30/85 (35%) | ||
RRM2_hnRNPAB | 150..229 | CDD:409997 | 31/85 (36%) | ||
Rb97D | NP_001014671.1 | RRM1_hnRNPA_like | 33..110 | CDD:241022 | 28/76 (37%) |
RRM2_hnRNPA_like | 124..196 | CDD:240774 | 28/71 (39%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1202220at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |