DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HNRNPAB and Rb97D

DIOPT Version :9

Sequence 1:NP_112556.2 Gene:HNRNPAB / 3182 HGNCID:5034 Length:332 Species:Homo sapiens
Sequence 2:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster


Alignment Length:317 Identity:93/317 - (29%)
Similarity:145/317 - (45%) Gaps:79/317 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    58 DQINASKNEED-------AGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGF 115
            |.|..:..|||       ..|:|:|||:..|::::||.::.::|:|||..:..|..|.|||||||
  Fly    13 DVIVLADREEDDICELEHLRKLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGF 77

Human   116 ILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKD-------PVKKIFVGGLNPEATEEKIREY 173
            |.:..:..|::..:.:.|.:||:.::.|:|:...:.       .|||:|||||.....||.:|||
  Fly    78 ITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREY 142

Human   174 FGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKEVY--- 235
            |.:||.:.:::|..|....|||||.|:.|.:.:.|.|.:.||.|.:.....::|    |.:|   
  Fly   143 FLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVK----KSIYNLD 203

Human   236 QQQQYGSGGRGNR-----NRGNRGSGGG---GGGGGQSQSW------NQGYG------------- 273
            ::::...||..|.     |:..:..|||   ..|..|:.|:      .|..|             
  Fly   204 KKEKQQPGGLANAIKPSLNQQQQQQGGGQQPPNGNMQAPSFRPPVPPQQAMGPYQQQPPPAPMSA 268

Human   274 -----NYWN------QGYGYQQ-------GYGPGYGGYDYSPYGYYGYG------PG 306
                 |||.      ..| |||       |:||      |.|....|:.      ||
  Fly   269 PPPNFNYWGPPPPAMPPY-YQQPPPQQMNGWGP------YPPPQQNGWNAPPPPPPG 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HNRNPABNP_112556.2 CBFNT 1..70 CDD:311868 5/18 (28%)
RRM1_hnRNPAB 66..145 CDD:410151 30/85 (35%)
RRM2_hnRNPAB 150..229 CDD:409997 31/85 (36%)
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 28/76 (37%)
RRM2_hnRNPA_like 124..196 CDD:240774 28/71 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.