DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HNRNPAB and sqd

DIOPT Version :9

Sequence 1:NP_112556.2 Gene:HNRNPAB / 3182 HGNCID:5034 Length:332 Species:Homo sapiens
Sequence 2:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster


Alignment Length:341 Identity:130/341 - (38%)
Similarity:179/341 - (52%) Gaps:61/341 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    33 GTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVV 97
            |.|:..|..||     :|:.||:..:|..||...:|..|:|||||||:|::|:|:|:|.|:||:.
  Fly    24 GPGSENGDAGA-----AGSTNGSSDNQSAASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIE 83

Human    98 DCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLN 162
            ...:|.||.|||||||.||:|.:..:::||....||.::.:.:|||||.|..    .|||||||.
  Fly    84 SINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKARH----GKIFVGGLT 144

Human   163 PEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIK 227
            .|.::|:|:.|||:||.|..:|:|.|.:.::|:||.||||..|:.|..:|:.....::|.:.::|
  Fly   145 TEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVK 209

Human   228 VAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGGGGQSQSWNQGYGNYWNQGYGYQQGYGPGYGG 292
            .|.||   .:.|...|.||....|.||..||.||.|       ||.|.|: |.|...|||.||||
  Fly   210 RATPK---PENQMMGGMRGGPRGGMRGGRGGYGGRG-------GYNNQWD-GQGSYGGYGGGYGG 263

Human   293 YDYSPYG-YY--GYGPGYDYSQ--------------------------------------GSTNY 316
            |....|| ||  ||..||||..                                      |..|.
  Fly   264 YGAGGYGDYYAGGYYNGYDYGYDGYGYGGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNG 328

Human   317 GKSQRRGGHQNNYKPY 332
            ||.:..||.|..::||
  Fly   329 GKQRGGGGRQQRHQPY 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HNRNPABNP_112556.2 CBFNT 1..70 CDD:311868 12/36 (33%)
RRM1_hnRNPAB 66..145 CDD:410151 37/78 (47%)
RRM2_hnRNPAB 150..229 CDD:409997 31/78 (40%)
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 33/70 (47%)
RRM2_hnRNPD_like 137..211 CDD:240775 31/73 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8162
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 226 1.000 Inparanoid score I3498
Isobase 1 0.950 - 0.918296 Normalized mean entropy S1109
OMA 1 1.010 - - QHG45859
OrthoDB 1 1.010 - - D496221at33208
OrthoFinder 1 1.000 - - FOG0001417
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR48033
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4769
SonicParanoid 1 1.000 - - X985
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1313.020

Return to query results.
Submit another query.