DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HNRNPAB and sqd-1

DIOPT Version :9

Sequence 1:NP_112556.2 Gene:HNRNPAB / 3182 HGNCID:5034 Length:332 Species:Homo sapiens
Sequence 2:NP_001380080.1 Gene:sqd-1 / 177392 WormBaseID:WBGene00022235 Length:308 Species:Caenorhabditis elegans


Alignment Length:313 Identity:98/313 - (31%)
Similarity:151/313 - (48%) Gaps:47/313 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    43 ATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNT 107
            ||....:||.:....:..:::|..||. |:||||:|.:.:.:||..:||::|||....:|.|...
 Worm     3 ATDNKINGNASETIKENGHSTKGNEDK-KIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTN 66

Human   108 GRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIRE 172
            ||||||.|:.|......:..|..:|..:.|:.::.|.|.:.:.   ||:|||||..:.:|:.:|.
 Worm    67 GRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAKSREN---KKVFVGGLPSDYSEQDLRS 128

Human   173 YFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQ 237
            :|.:||:::.||.|.|.:...||.|.||.|:|||...|...:...|....:|::|.|.|    |.
 Worm   129 HFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVP----QG 189

Human   238 QQY-GSGGRGNRNRGNRGSGGGGGGGGQSQSWNQ-----------GYGNYWNQGY---------- 280
            ::: |:.||....||..|..||....|....|.|           .:|:::..||          
 Worm   190 KRFPGAQGRMPGGRGMYGGRGGNNNSGWYAGWGQIGAMPYGATGAAWGDWYGNGYYGQQGAAHHN 254

Human   281 --GYQQGYGPGYGGYDYSPYGYYGYGPGYDYSQGSTNYGKSQRRGGHQNNYKP 331
              |..||||.||       ..:.|...|:||.|     .:..|:|   ||.:|
 Worm   255 NSGSSQGYGSGY-------QSFAGNNSGFDYQQ-----AQGARQG---NNGQP 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HNRNPABNP_112556.2 CBFNT 1..70 CDD:311868 7/26 (27%)
RRM1_hnRNPAB 66..145 CDD:410151 29/78 (37%)
RRM2_hnRNPAB 150..229 CDD:409997 29/78 (37%)
sqd-1NP_001380080.1 RRM2_NsCP33_like 30..104 CDD:410187 27/73 (37%)
RRM_SF 111..185 CDD:418427 28/73 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I7734
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45859
OrthoDB 1 1.010 - - D496221at33208
OrthoFinder 1 1.000 - - FOG0001417
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4769
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.