Sequence 1: | NP_001284894.1 | Gene: | CG32762 / 318198 | FlyBaseID: | FBgn0052762 | Length: | 200 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_068544.2 | Gene: | Ecel1 / 60417 | RGDID: | 61806 | Length: | 775 | Species: | Rattus norvegicus |
Alignment Length: | 198 | Identity: | 38/198 - (19%) |
---|---|---|---|
Similarity: | 57/198 - (28%) | Gaps: | 81/198 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 ASGTTQPPSRRPPVTTARTTPRNCPLFPQVCSQTSPRVCGRTARG------ECQRFE-------- 69
Fly 70 ---NICHLMLANVLRQPEGVRHTRDIDCRNVRGTGAANRRPCYNPCPARPVVCKRSPPSQQICVR 131
Fly 132 SRDNRQCKVLANSCQLRNQNC---HSQPRNNWLR-----TDRRRCGQL-QLGDKPQNCIRVPVRP 187
Fly 188 RPT 190 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32762 | NP_001284894.1 | None | |||
Ecel1 | NP_068544.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 23..51 | 11/47 (23%) | |
M13 | 121..773 | CDD:341056 | 12/51 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG3590 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |