powered by:
Protein Alignment CG32762 and Nepl17
DIOPT Version :9
Sequence 1: | NP_001284894.1 |
Gene: | CG32762 / 318198 |
FlyBaseID: | FBgn0052762 |
Length: | 200 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_651641.1 |
Gene: | Nepl17 / 43408 |
FlyBaseID: | FBgn0039609 |
Length: | 681 |
Species: | Drosophila melanogaster |
Alignment Length: | 37 |
Identity: | 13/37 - (35%) |
Similarity: | 15/37 - (40%) |
Gaps: | 3/37 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 CSQTSPRVCGRTA---RGECQRFENICHLMLANVLRQ 82
|.......||..| ....|:..||..||.||.||:
Fly 58 CDDFYGYACGNYATINAATSQKDTNIRQLMFANYLRR 94
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32762 | NP_001284894.1 |
None |
Nepl17 | NP_651641.1 |
PepO |
49..672 |
CDD:226118 |
13/37 (35%) |
M13 |
55..678 |
CDD:189000 |
13/37 (35%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG3590 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.