DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32762 and Nepl15

DIOPT Version :9

Sequence 1:NP_001284894.1 Gene:CG32762 / 318198 FlyBaseID:FBgn0052762 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_651098.2 Gene:Nepl15 / 42701 FlyBaseID:FBgn0039024 Length:686 Species:Drosophila melanogaster


Alignment Length:198 Identity:32/198 - (16%)
Similarity:61/198 - (30%) Gaps:65/198 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CQRFENICHLMLAN----VLRQPEGVR------HTRDIDCRNVRGTGAANRRPCYNPCPAR---- 115
            |....::.|.:.||    :||..:...      ..::..|.|......||....:   |||    
  Fly    18 CAIDASVPHPLAANYSIDILRLAKAAHIKAYMGDEKEQACNNFYNYACANWPRLH---PARKSKT 79

  Fly   116 ---------PVVCKRSPPSQQICVRSRDN---RQCKVLANSCQLRNQNCHS-------------- 154
                     .:..::|....:...|..:|   ||.|....||:|:..:..|              
  Fly    80 RTNYLEELQELYIRKSADMLKSATRGAENSADRQLKYFYGSCRLQTNDTRSALNTLQNVTDFRGG 144

  Fly   155 ----------QPRNNWLRTD---RRRCGQ---------LQLGDKPQNCIRVPVRPRPTRAQHHST 197
                      |...:||:..   :|:.|.         |...::..:.:::.....|...:|:..
  Fly   145 WPEIRVASWYQYEYDWLQVVANLKRKLGVDIFIGLEVILDYKEEKMHRLKIGAPQFPMSRRHYLH 209

  Fly   198 QHY 200
            .|:
  Fly   210 PHF 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32762NP_001284894.1 None
Nepl15NP_651098.2 M13 57..684 CDD:189000 26/159 (16%)
PepO 57..677 CDD:226118 26/159 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.