DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32762 and Nepl10

DIOPT Version :9

Sequence 1:NP_001284894.1 Gene:CG32762 / 318198 FlyBaseID:FBgn0052762 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_610787.1 Gene:Nepl10 / 36366 FlyBaseID:FBgn0033742 Length:633 Species:Drosophila melanogaster


Alignment Length:71 Identity:21/71 - (29%)
Similarity:27/71 - (38%) Gaps:18/71 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PEGVRHTRDIDCRNVRGTGAANRRPCYNPCPARPVVCKRSPPSQQICVRSRDNRQCKVLANSCQL 147
            |..:.|.||.:..||   ...|.|..     |....|:.||.|  :|...|...    :|||   
  Fly   580 PPVIAHDRDDERVNV---SVGNLRQF-----AYDFNCETSPSS--VCEMWRPGD----VANS--- 627

  Fly   148 RNQNCH 153
             |:|.|
  Fly   628 -NRNVH 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32762NP_001284894.1 None
Nepl10NP_610787.1 GluZincin 41..608 CDD:301352 9/35 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.