DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32762 and nep-18

DIOPT Version :9

Sequence 1:NP_001284894.1 Gene:CG32762 / 318198 FlyBaseID:FBgn0052762 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_494297.1 Gene:nep-18 / 186911 WormBaseID:WBGene00019343 Length:701 Species:Caenorhabditis elegans


Alignment Length:235 Identity:43/235 - (18%)
Similarity:65/235 - (27%) Gaps:108/235 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MTLLWS--MASGTTQPPSRRPPVTTAR---------TTPRNCPLFPQVCSQTSPRVCGRTARGEC 65
            |..||:  ..||::..|:..|....::         ...:|..:.|  |.......|||.:.   
 Worm     4 MIALWASLWPSGSSNAPNGSPETCWSKECVGVLAMIKNYQNASVDP--CEDFFEHTCGRYSE--- 63

  Fly    66 QRFENICHLMLAN---------VLRQPEGVRHTRDIDCRNVRGTGAANRRPCYNPCPARPVVCKR 121
                   |:|..|         :|.|...:          .|.|...|.:|              
 Worm    64 -------HVMDDNSWGYVQYKQLLYQVFAI----------ARKTNKFNSKP-------------- 97

  Fly   122 SPPSQQICVRSRDNRQCKVLANSCQLR---NQNCHSQPRN-------------NW---------- 160
                         |.|.::...||..|   :::.....||             ||          
 Worm    98 -------------NEQLRIFTKSCLDRKEMDEDTFQDLRNDIEERGGFPMIDPNWNEEKFDLSDM 149

  Fly   161 ----LRTDRRRCGQLQL-------GDKPQNCIRVPVRPRP 189
                |..:|.|.|.|.:       |:|..|  |:.|.|.|
 Worm   150 LAKYLSINRNRMGFLSVEPYAAIEGNKSVN--RLYVSPGP 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32762NP_001284894.1 None
nep-18NP_494297.1 PepO 42..692 CDD:226118 36/197 (18%)
M13 47..699 CDD:189000 35/192 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.