powered by:
Protein Alignment CG32762 and nep-12
DIOPT Version :9
Sequence 1: | NP_001284894.1 |
Gene: | CG32762 / 318198 |
FlyBaseID: | FBgn0052762 |
Length: | 200 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001364537.1 |
Gene: | nep-12 / 173824 |
WormBaseID: | WBGene00017842 |
Length: | 832 |
Species: | Caenorhabditis elegans |
Alignment Length: | 53 |
Identity: | 15/53 - (28%) |
Similarity: | 22/53 - (41%) |
Gaps: | 1/53 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 QVCSQTSPRVCGRTARGECQRFENICHLMLANVLRQPEGVRHTRDIDCRNVRG 99
|..|:..|:. ||...|:....|||.......|..|...:|..|:.:.|.:.|
Worm 707 QYGSKIEPQT-GRKVDGKMTIGENIADNGGLRVAFQAYQLRSDREKETRRLPG 758
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32762 | NP_001284894.1 |
None |
nep-12 | NP_001364537.1 |
M13 |
171..830 |
CDD:341056 |
15/53 (28%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG3590 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.