DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32762 and nep-12

DIOPT Version :9

Sequence 1:NP_001284894.1 Gene:CG32762 / 318198 FlyBaseID:FBgn0052762 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001364537.1 Gene:nep-12 / 173824 WormBaseID:WBGene00017842 Length:832 Species:Caenorhabditis elegans


Alignment Length:53 Identity:15/53 - (28%)
Similarity:22/53 - (41%) Gaps:1/53 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QVCSQTSPRVCGRTARGECQRFENICHLMLANVLRQPEGVRHTRDIDCRNVRG 99
            |..|:..|:. ||...|:....|||.......|..|...:|..|:.:.|.:.|
 Worm   707 QYGSKIEPQT-GRKVDGKMTIGENIADNGGLRVAFQAYQLRSDREKETRRLPG 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32762NP_001284894.1 None
nep-12NP_001364537.1 M13 171..830 CDD:341056 15/53 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.