DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Prss12

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_445956.1 Gene:Prss12 / 85266 RGDID:69238 Length:761 Species:Rattus norvegicus


Alignment Length:260 Identity:90/260 - (34%)
Similarity:130/260 - (50%) Gaps:43/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGH-VCGGAVISQRVVCSAAHCYAI--NTSVPLVY 98
            :|:||........|:|.|:|.:|.|    |.|. :||..::|...|.:||||:..  |.|.....
  Rat   516 RIIGGNNSLRGAWPWQASLRLKSTH----GDGRLLCGATLLSSCWVLTAAHCFTRYGNNSRSYAV 576

  Fly    99 RDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNG-----------FI 152
            |..:.:.:|        .:.|.|:..||:||.|::|...:.:.||||:.|.|           .:
  Rat   577 RVGDYHTLV--------PEGFEQDIGVQQIVIHRNYRPDSSDYDIALVRLQGSGEQCARLSTHVL 633

  Fly   153 PWESPGVRAIPLAIKAPEE-GTTCLIHGWGKVTMKEKSASLQQAPVPILNKELCQVIYK--LPAS 214
            |      ..:||..:.|:: .:.|.|.|||. |.:..|.:||||.||:|.|..|:..||  ....
  Rat   634 P------ACLPLWRERPQKTASNCHITGWGD-TGRAYSRTLQQAAVPLLPKRFCKERYKGLFTGR 691

  Fly   215 QMCAGFLQ--GGIDACQGDSGGPLICDGR-----LAGIISWGVGCADPGYPGVYTNVSHFLKWIR 272
            .:|||.||  ..:|:|||||||||:|:..     :.|:.|||.||.....|||||.|..|:.||:
  Rat   692 MLCAGNLQEDNRVDSCQGDSGGPLMCEKPDETWVVYGVTSWGYGCGIKDTPGVYTRVPAFVPWIK 756

  Fly   273  272
              Rat   757  756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 88/257 (34%)
Tryp_SPc 38..273 CDD:238113 90/259 (35%)
Prss12NP_445956.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..89
KR 83..159 CDD:214527
SR 166..265 CDD:214555
SRCR 171..266 CDD:278931
SR 273..372 CDD:214555
SRCR 278..371 CDD:278931
SR 386..485 CDD:214555
SRCR 391..485 CDD:278931
Zymogen activation region. /evidence=ECO:0000250 505..516 90/260 (35%)
Tryp_SPc 516..755 CDD:214473 88/257 (34%)
Tryp_SPc 517..758 CDD:238113 90/259 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.