DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Tmprss5

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001346389.1 Gene:Tmprss5 / 80893 MGIID:1933407 Length:455 Species:Mus musculus


Alignment Length:251 Identity:89/251 - (35%)
Similarity:128/251 - (50%) Gaps:35/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHC-YAINTSVPLVYRD 100
            :||||..|...:.|:|.||.        .|..|.||.:|::...|.:|||| |:...|....:| 
Mouse   217 RIVGGQAVASGRWPWQASVM--------LGSRHTCGASVLAPHWVVTAAHCMYSFRLSRLSSWR- 272

  Fly   101 PELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPW-ESPGVRAIPL 164
              ::..:....|:    |..|..:|::|:.|..|:....:.|:|||.|...|.: ::.|...:| 
Mouse   273 --VHAGLVSHGAV----RQHQGTMVEKIIPHPLYSAQNHDYDVALLQLRTPINFSDTVGAVCLP- 330

  Fly   165 AIKAPEE----GTTCLIHGWGKV--TMKEKSASLQQAPVPILNKELC--QVIYK--LPASQMCAG 219
               |.|:    |:.|.:.|||..  :....|.:||...||:|:..||  ..:|.  |....:|||
Mouse   331 ---AKEQHFPWGSQCWVSGWGHTDPSHTHSSDTLQDTMVPLLSTYLCNSSCMYSGALTHRMLCAG 392

  Fly   220 FLQGGIDACQGDSGGPLICDG----RLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            :|.|..|||||||||||:|..    .|.|::|||.|||:|..||||..|:.||.||
Mouse   393 YLDGRADACQGDSGGPLVCPSGDTWHLVGVVSWGRGCAEPNRPGVYAKVAEFLDWI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 87/249 (35%)
Tryp_SPc 38..273 CDD:238113 89/250 (36%)
Tmprss5NP_001346389.1 SRCR_2 116..213 CDD:317845
Tryp_SPc 217..448 CDD:214473 87/249 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.