DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Cfi

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_077071.1 Gene:Cfi / 79126 RGDID:620429 Length:604 Species:Rattus norvegicus


Alignment Length:315 Identity:90/315 - (28%)
Similarity:134/315 - (42%) Gaps:88/315 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HSGITQSQIG-------QPTATASPFV---------ILPK---------------IVGGYTVTID 47
            |.|:.:|..|       :.|...:|.:         :|||               :|||....:.
  Rat   307 HKGLARSDQGGETEIETEETEMLTPDMDTERKRIKSLLPKLSCGVKRNTHIRRKRVVGGKPAEMG 371

  Fly    48 QVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHC--------YAINTSVPLVYRDPELY 104
            ..|:||:::.        |....|||..|....:.:||||        |.:.||: |.:..|...
  Rat   372 DYPWQVAIKD--------GDRITCGGIYIGGCWILTAAHCVRPSRYRNYQVWTSL-LDWLKPNSQ 427

  Fly   105 VVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPG------VRAIP 163
            :.|.|               |.|:|.|:.|||:|.:|||||:.:.     :.||      :.::|
  Rat   428 LAVQG---------------VSRVVVHEKYNGATYQNDIALVEMK-----KHPGKKECELINSVP 472

  Fly   164 LAIK-AP---EEGTTCLIHGWGKVTMKEKSASLQQAPVPILNKELCQVIYK---LPASQMCAGFL 221
            ..:. :|   :....|:|.|||:....:|..||:...|.::..  |...|.   ......|||..
  Rat   473 ACVPWSPYLFQPNDRCIISGWGREKDNQKVYSLRWGEVDLIGN--CSRFYPGRYYEKEMQCAGTS 535

  Fly   222 QGGIDACQGDSGGPLICDG-----RLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            .|.||||:|||||||:|..     .:.||:|||..|..|.:|||||.|:.:..||
  Rat   536 DGSIDACKGDSGGPLVCKDVNNVTYVWGIVSWGENCGKPEFPGVYTRVASYFDWI 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 80/274 (29%)
Tryp_SPc 38..273 CDD:238113 81/260 (31%)
CfiNP_077071.1 FIMAC 46..111 CDD:214493
SR 117..220 CDD:214555
SRCR 122..219 CDD:278931
LDLa 228..258 CDD:197566
LDLa 264..298 CDD:294076
Tryp_SPc 361..590 CDD:214473 79/259 (31%)
Tryp_SPc 362..591 CDD:238113 81/260 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.