DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and f7

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001072819.1 Gene:f7 / 780280 XenbaseID:XB-GENE-5787186 Length:452 Species:Xenopus tropicalis


Alignment Length:287 Identity:86/287 - (29%)
Similarity:126/287 - (43%) Gaps:59/287 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QIGQPTATASPFVILP--------------KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVC 71
            ::|....:..|.|..|              :||||......:.|:|..:....|        .:|
 Frog   181 KLGADGLSCEPTVNYPCGKIPVLKNVNKRARIVGGDMCPKGECPWQALLMYNEI--------FIC 237

  Fly    72 GGAVISQRVVCSAAHCYAINTSVPLVYRDPE-LYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYN 135
            ||.:|:...|.:||||..     ||    || ...||.|...|...:...||..|.:|:.|:.|.
 Frog   238 GGTLIAPNWVITAAHCLK-----PL----PENKLTVVLGEHRIGTPEGTEQESKVSKIIMHEHYY 293

  Fly   136 GSTL--ENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTT---------CLIHGWGKVTMKEKS 189
            ||..  :||||||.|...:.:..   ..:||.:  ||:...         ..:.|||:  :.|..
 Frog   294 GSKTNNDNDIALLKLTTPVNYTD---YVVPLCL--PEKQFAVQELLSIRYSTVSGWGR--LLESG 351

  Fly   190 AS---LQQAPVPILNKELC--QVIYKLPASQMCAGFLQGGIDACQGDSGGPLICDGR----LAGI 245
            |:   ||:..:|.:..:.|  |....:..:..|||:..|..|:|:||||||.....:    |.||
 Frog   352 ATPELLQRVQLPRVKTQDCIRQTQMNISQNMFCAGYTDGSKDSCKGDSGGPHATQYKNTHFLTGI 416

  Fly   246 ISWGVGCADPGYPGVYTNVSHFLKWIR 272
            :|||:|||.....||||.||.:.:||:
 Frog   417 VSWGLGCAKKEKYGVYTRVSRYTEWIK 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 80/254 (31%)
Tryp_SPc 38..273 CDD:238113 82/256 (32%)
f7NP_001072819.1 Gla 67..107 CDD:366184
EGF_CA 108..144 CDD:238011
FXa_inhibition 153..189 CDD:373209 1/7 (14%)
Tryp_SPc 212..445 CDD:238113 82/256 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.