DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and mettl7a.2

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_002933742.3 Gene:mettl7a.2 / 779612 XenbaseID:XB-GENE-22069551 Length:244 Species:Xenopus tropicalis


Alignment Length:187 Identity:45/187 - (24%)
Similarity:73/187 - (39%) Gaps:34/187 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 DRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIH 178
            ||..:....||::||.  |:|| ..:.::...||.| ...:..|..:   |||.....||.....
 Frog    29 DRIAKVVLPYLLERIT--KEYN-RKMGDEKRQLFRN-LSDFAGPSGK---LAILDLGCGTGANFQ 86

  Fly   179 GW---GKVTMKEKSASLQQAPVPILNKELCQVIYKLPASQMCAGFLQGGIDACQGDSGGPLICDG 240
            .:   .|||..:.:.:.:.    .|.:.|        |......| |..:.| .|::..|| .||
 Frog    87 YYPAGSKVTCMDPNPNFKS----FLGRSL--------AENQHVDF-QSFVVA-PGENMAPL-ADG 136

  Fly   241 RLAGIISWGVGCADPGYPGVYTNV---------SHFLKWIRRANASLDYSEYRQIPP 288
            .:..::...|.|:......|.|.|         .:||:.:|..:||.:|...|.:.|
 Frog   137 SMDVVVCTLVLCSVREVEAVLTEVLRVLKPGGAYYFLEHVRADSASWNYFFQRILDP 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 39/168 (23%)
Tryp_SPc 38..273 CDD:238113 39/170 (23%)
mettl7a.2XP_002933742.3 Methyltransf_11 75..172 CDD:400514 21/111 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.