DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and tmprss4a

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_005157547.1 Gene:tmprss4a / 777630 ZFINID:ZDB-GENE-061103-631 Length:458 Species:Danio rerio


Alignment Length:247 Identity:86/247 - (34%)
Similarity:128/247 - (51%) Gaps:33/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :||||....|...|:|||::        |...|.|||::::...|.:||||:..:....|     
Zfish   223 RIVGGKDADIANWPWQVSLQ--------YSGQHTCGGSLVTPNWVVTAAHCFNGDGRKAL----- 274

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPW-ESPGVRAIP-- 163
            ..:.||:|.:.:..|   ...| |:.|:.:.:|..:..:.||.::.|...|.. ||.....:|  
Zfish   275 SRWTVVSGITYLSST---PSSY-VKEIIVNSNYKPAESDFDITMIKLQSPITLSESRRPVCLPPQ 335

  Fly   164 -LAIKAPEEGTTCLIHGWGKVTMKEKSAS--LQQAPVPILNKELCQ--VIY--KLPASQMCAGFL 221
             |.:|.   |...::.|||.:..|..|.|  ||:|.:.:::...|.  .:|  .:....:|||.:
Zfish   336 NLGLKG---GDGLVVTGWGHMAEKGGSLSSMLQKAQIQVIDSAQCSSPTVYGSSITPRMICAGVM 397

  Fly   222 QGGIDACQGDSGGPLI--CD-GRLAGIISWGVGCADPGYPGVYTNVSHFLKW 270
            .||:|||||||||||:  .| ..|.|::|||||||.||:|||||||...|.|
Zfish   398 AGGVDACQGDSGGPLVHLADRWVLVGVVSWGVGCARPGFPGVYTNVDQMLDW 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 86/247 (35%)
Tryp_SPc 38..273 CDD:238113 86/246 (35%)
tmprss4aXP_005157547.1 LDLa 74..105 CDD:238060
SRCR_2 121..218 CDD:295335
Tryp_SPc 223..449 CDD:214473 85/245 (35%)
Tryp_SPc 224..449 CDD:238113 85/244 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.