DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Prss8

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:355 Identity:115/355 - (32%)
Similarity:165/355 - (46%) Gaps:72/355 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDHLWMCLLIVATHSGI----TQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIH 61
            ::.:.:.||:....|||    |::..|.        ||.|:|.||.:....|.|:|||:.     
Mouse    12 LEAVTILLLLGLLQSGIRADGTEASCGA--------VIQPRITGGGSAKPGQWPWQVSIT----- 63

  Fly    62 ERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQ 126
               |...|||||:::|.:.|.|||||:....|       .|.|.|..|:..:|.....|..:.|.
Mouse    64 ---YDGNHVCGGSLVSNKWVVSAAHCFPREHS-------REAYEVKLGAHQLDSYSNDTVVHTVA 118

  Fly   127 RIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAI--PLAIKAPEEGTTCLIHGWGKVTMK--- 186
            :|:.|..|.....:.||||:.|:..:.: |..:|.|  |.|..:...|..|.:.|||.|...   
Mouse   119 QIITHSSYREEGSQGDIALIRLSSPVTF-SRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSL 182

  Fly   187 EKSASLQQAPVPILNKELCQVIYKLPA----------SQMCAGFLQGGIDACQGDSGGPLIC--D 239
            :....|||..||::::|.|..:|.:.|          ..:|||:::||.|||||||||||.|  :
Mouse   183 QTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPME 247

  Fly   240 G--RLAGIISWGVGCADPGYPGVYTNVSHFLKWIRRANASLDYSEYRQIPPL-------NLASRR 295
            |  .||||:|||..|..|..|||||..|.:..||....|.|   :.|.:|..       :|.:..
Mouse   248 GIWYLAGIVSWGDACGAPNRPGVYTLTSTYASWIHHHVAEL---QPRVVPQTQESQPDGHLCNHH 309

  Fly   296 SVSSSC---------------LGIGVLALA 310
            .|.||.               |.:|:|:||
Mouse   310 PVFSSAAAPKLLRPVLFLPLGLTLGLLSLA 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 90/252 (36%)
Tryp_SPc 38..273 CDD:238113 92/253 (36%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 92/254 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.