DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and XB5723326

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001037931.1 Gene:XB5723326 / 733551 XenbaseID:XB-GENE-5723327 Length:349 Species:Xenopus tropicalis


Alignment Length:270 Identity:72/270 - (26%)
Similarity:121/270 - (44%) Gaps:53/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PFVILPKIVGGYTVTIDQV----PFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAI- 90
            ||  ..::...|:..::.|    |:.||::::.    ..|..|:|.|.:::...:.:||||:.. 
 Frog     7 PF--YTEVKASYSTELNPVEGKWPWIVSIQKKV----ELGYKHICAGTILNNEWIITAAHCFKDW 65

  Fly    91 ---NTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLN--- 149
               :.:.||        .|:.|:..:......||...|::::.|..|:..|..|||||:.|:   
 Frog    66 KEGDPTTPL--------RVLLGTFYLSEIGLRTQSRGVKQLIKHDQYDPITESNDIALIQLDKQV 122

  Fly   150 --------GFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGK--VTMKEKSASLQQAPVPILNKEL 204
                    ...|.||..::.:          ..|.|.|||.  ..:.|.|..||:|.|..::.:.
 Frog   123 EFSDHIQQACFPKESADLKDL----------IDCSIAGWGAQGKHLDEPSQFLQEAQVERIDTKH 177

  Fly   205 CQVIYK--LPASQMCAGFLQGGIDACQGDSGGPLICDGR------LAGIISWGVGCADPGYPGVY 261
            |...|:  |..:.:|||..:|....|.||.|.||:|..:      :.||::||.||.....||||
 Frog   178 CNKWYQGILGENHLCAGHRKGPEKTCNGDRGSPLMCRTKKNNVYSVIGILNWGSGCGQTRSPGVY 242

  Fly   262 TNVSHFLKWI 271
            :.:...:|||
 Frog   243 SPIQSHIKWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 68/262 (26%)
Tryp_SPc 38..273 CDD:238113 70/263 (27%)
XB5723326NP_001037931.1 Tryp_SPc 25..252 CDD:214473 66/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.