DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and TMPRSS2

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001128571.1 Gene:TMPRSS2 / 7113 HGNCID:11876 Length:529 Species:Homo sapiens


Alignment Length:257 Identity:87/257 - (33%)
Similarity:126/257 - (49%) Gaps:45/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :||||.:......|:|||:..:::        |||||::|:...:.:||||    ...||  .:|
Human   292 RIVGGESALPGAWPWQVSLHVQNV--------HVCGGSIITPEWIVTAAHC----VEKPL--NNP 342

  Fly   102 ELYVVVAGSSAIDRTD--RFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWE--------- 155
            ..:...||   |.|..  .:...|.|::::.|.:|:..|..|||||:.|...:.:.         
Human   343 WHWTAFAG---ILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLP 404

  Fly   156 SPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSAS-LQQAPVPILNKELCQVIY----KLPASQ 215
            :||:      :..||:  .|.|.|||....|.|::. |..|.|.::..:.|...|    .:..:.
Human   405 NPGM------MLQPEQ--LCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAM 461

  Fly   216 MCAGFLQGGIDACQGDSGGPLICDGR----LAGIISWGVGCADPGYPGVYTNVSHFLKWIRR 273
            :|||||||.:|:|||||||||:....    |.|..|||.|||....||||.||..|..||.|
Human   462 ICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYR 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 84/253 (33%)
Tryp_SPc 38..273 CDD:238113 86/254 (34%)
TMPRSS2NP_001128571.1 DUF3824 <44..91 CDD:289625
LDLa 150..185 CDD:238060
SRCR_2 190..283 CDD:292133
Tryp_SPc 292..521 CDD:214473 84/253 (33%)
Tryp_SPc 293..524 CDD:238113 87/256 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.