DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Klk10

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_598473.1 Gene:Klk10 / 69540 MGIID:1916790 Length:278 Species:Mus musculus


Alignment Length:242 Identity:71/242 - (29%)
Similarity:115/242 - (47%) Gaps:39/242 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSS 111
            |..|:|||:        .:.|...|.|.::.|..|.:||||:   .:.||..|..:.::::    
Mouse    56 DYHPWQVSL--------FHNLQFQCAGVLVDQNWVLTAAHCW---RNKPLRARVGDDHLLL---- 105

  Fly   112 AIDRTDRFTQEYL--VQRIVGHKDY---NGSTL-----ENDIALLFLNGFIPWESPGVRAIPLAI 166
                   |.:|.|  ....|.|..|   :|..|     |:|:.:|.|:..:...| .|..:.|..
Mouse   106 -------FQKEQLRSTSSPVFHPKYQACSGPILPHRSDEHDLMMLKLSSPVMLTS-NVHPVQLPF 162

  Fly   167 KAPEEGTTCLIHGWGKVTMK--EKSASLQQAPVPILNKELCQVIYK--LPASQMCAGFLQGGIDA 227
            :..:.|..|.:.|||....:  :.:.||..:.|.:|:::.|:..|.  :..|.:||. ..|..|:
Mouse   163 RCSQPGQECQVSGWGTSASRRVKYNRSLSCSKVTLLSQKQCETFYPGVITNSMICAE-ADGNQDS 226

  Fly   228 CQGDSGGPLICDGRLAGIISWGV-GCADPGYPGVYTNVSHFLKWIRR 273
            ||.||||||:||..|.|::|||: .|....:|.||:.:..:..||||
Mouse   227 CQSDSGGPLVCDDTLHGVLSWGIYPCGAAQHPSVYSEICKYTPWIRR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 67/238 (28%)
Tryp_SPc 38..273 CDD:238113 69/240 (29%)
Klk10NP_598473.1 Tryp_SPc 50..271 CDD:214473 67/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.