DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Prss56

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_006529921.1 Gene:Prss56 / 69453 MGIID:1916703 Length:605 Species:Mus musculus


Alignment Length:305 Identity:100/305 - (32%)
Similarity:147/305 - (48%) Gaps:69/305 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG--HVCGGAVISQRVVCSAAHCYAINTSVPLVYR 99
            :||||.|......|:.|.::          ||  .:|||.:::...|.:||||:| ..|..|::.
Mouse   109 RIVGGSTAPSGAWPWLVRLQ----------LGGLPLCGGVLVAASWVLTAAHCFA-GASNELLWT 162

  Fly   100 DPELYVVVA----GSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWE--SPG 158
                 |::|    |..|        :|..|.||:.|..::..|..||:||:.|     |.  ||.
Mouse   163 -----VMLAEGPQGEQA--------EEVQVNRILPHPKFDPQTFHNDLALVQL-----WTPVSPE 209

  Fly   159 VRAIPLAI----KAPEEGTTCLIHGWGKVTMK-EKSASLQQAPVPILNKELCQVIY---KLPASQ 215
            ..|.|:.:    :.|..||.|.|.|||.:... .:|.::::|.||:|:.:.||.:.   ..|::.
Mouse   210 GPARPICLPQGSREPPAGTPCAIAGWGALFEDGPESEAVREARVPLLSADTCQKVLGPGLRPSTM 274

  Fly   216 MCAGFLQGGIDACQGDSGGPLICDGR-------LAGIISWGVGCADPGYPGVYTNVSHFLKWIRR 273
            :|||:|.||||:|||||||||.|...       |.|:.|||.||.:||.|||||.|:.|..|::.
Mouse   275 LCAGYLAGGIDSCQGDSGGPLTCSEPGPRPREVLFGVTSWGDGCGEPGKPGVYTRVTVFKDWLQE 339

  Fly   274 ---ANASLDYSEYRQIPPLNLASRRS------------VSSSCLG 303
               |..|......|::  ||..:|..            .:..|||
Mouse   340 QMSAGPSTREPSCREL--LNWNAREEEPFTDAPGLCAFYARQCLG 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 90/256 (35%)
Tryp_SPc 38..273 CDD:238113 91/257 (35%)
Prss56XP_006529921.1 Tryp_SPc 109..336 CDD:214473 90/255 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.