DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Prss55

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_008769022.1 Gene:Prss55 / 683415 RGDID:1586875 Length:321 Species:Rattus norvegicus


Alignment Length:310 Identity:94/310 - (30%)
Similarity:146/310 - (47%) Gaps:63/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLIVAT-----HSGIT---QSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERH 64
            ||:|.|     ..|:.   .|:||.           .:|:||....:.:.|:|||::...    |
  Rat     8 LLVVHTLEANVECGVRPLYDSRIGH-----------SRIIGGQEAEVGEFPWQVSIQEND----H 57

  Fly    65 YGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIV 129
                |.|||:::|:..:.:.|||:......|     .||.|.| |::.:..:   ..|..|..|:
  Rat    58 ----HFCGGSILSEWWILTVAHCFYSQELSP-----TELTVRV-GTNDLTTS---PMELQVTNII 109

  Fly   130 GHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAI---KAPEEGTTCLIHGWGKVTMKEKSA- 190
            .|||:...:::||||||.|...:.:..   :.:|:.:   ..|.....|.:.|||.....:|.: 
  Rat   110 RHKDFKRHSMDNDIALLLLANPLTFNE---QTVPICMPLQPTPPSWQECWVAGWGTTNSADKESM 171

  Fly   191 --SLQQAPVPILN-KELCQVIYKLPASQMCAGFLQGGIDACQGDSGGPLIC----DGR--LAGII 246
              .|.:.|:.|.: ||..|:...|..:.:||.:.....|||||||||||:|    |||  ..|||
  Rat   172 NMDLMKVPMRITDWKECLQLFPSLTTNMLCASYGNESFDACQGDSGGPLVCNQESDGRWYQVGII 236

  Fly   247 SWGVGCADPGYPGVYTNVSHFLKWIRRANASLDYSEYRQI--PPLNLASR 294
            |||..|...|.||:||.:::::.||.:..         ||  .||:|.|:
  Rat   237 SWGKSCGQKGSPGIYTVLANYILWIEKIT---------QIEGKPLDLNSQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 78/246 (32%)
Tryp_SPc 38..273 CDD:238113 80/247 (32%)
Prss55XP_008769022.1 Tryp_SPc 35..264 CDD:238113 80/248 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.