DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Prss41

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001128559.1 Gene:Prss41 / 681033 RGDID:1584711 Length:324 Species:Rattus norvegicus


Alignment Length:265 Identity:88/265 - (33%)
Similarity:124/265 - (46%) Gaps:49/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVY 98
            |..:||||......:.|:|.|:|.|..|.        |||:::|.|.|.:||||:.       .:
  Rat    51 IRSRIVGGIESVRGRWPWQASLRLRKFHR--------CGGSLLSHRWVLTAAHCFR-------KF 100

  Fly    99 RDPELYVVVAG----SSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFL------NGFIP 153
            .||:.:.|..|    ..:....:.|:..|.|:.|:.:.:  .....:|:|||.|      |.|| 
  Rat   101 LDPKKWTVQLGQLTSKPSFWNREAFSGRYRVKDIIINSE--DKLKYHDLALLRLASSVTYNKFI- 162

  Fly   154 WESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSA----SLQQAPVPILNKELCQVIYKLPAS 214
              .| |..:|.|..:..: ..|.:.|||.:....|..    .|::..|.:||...||.::.. ||
  Rat   163 --QP-VCVLPSASMSQHQ-PRCWVTGWGALQEDLKPLPPPYHLREVQVTVLNLSRCQELFSF-AS 222

  Fly   215 Q--------MCAGFLQGGIDACQGDSGGPLIC--DG--RLAGIISWGVGCADPGYPGVYTNVSHF 267
            :        .|||...|..|.|.|||||||:|  ||  ...||:|.||||..|..||:||||||.
  Rat   223 RYHLITRDVFCAGAEDGSADTCSGDSGGPLVCNMDGLWYQIGIVSRGVGCGRPKLPGIYTNVSHH 287

  Fly   268 LKWIR 272
            ..||:
  Rat   288 YDWIK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 85/259 (33%)
Tryp_SPc 38..273 CDD:238113 87/261 (33%)
Prss41NP_001128559.1 Tryp_SPc 54..291 CDD:214473 85/259 (33%)
Tryp_SPc 55..292 CDD:238113 86/259 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.