DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and st14a

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001035441.2 Gene:st14a / 678603 ZFINID:ZDB-GENE-030131-6496 Length:834 Species:Danio rerio


Alignment Length:246 Identity:90/246 - (36%)
Similarity:137/246 - (55%) Gaps:22/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :||||......:.|:|||:..::|       .|||||::|::|.:.:||||  :...|.:.|..|
Zfish   596 RIVGGQDAFEGEFPWQVSLHIKNI-------AHVCGGSIINERWIVTAAHC--VQDDVKIKYSQP 651

  Fly   102 ELYVVVAGSSAIDRTDRFT-QEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVR--AIP 163
            ..:.|..|..:  :.|:.| .:.|:::::.|..||..|.:|||||:.:...:.: |..:|  .:|
Zfish   652 GTWEVFLGLHS--QKDKLTATKRLLKQVIPHPYYNAYTYDNDIALMEMESPVTF-SDTIRPVCLP 713

  Fly   164 LAIKAPEEGTTCLIHGWGKVTMKEKSAS-LQQAPVPILNKELCQVIY--KLPASQMCAGFLQGGI 225
            .|......||:..|.|||........|: ||:|.|.|:|..:|..:.  ::.:...|||.|.||:
Zfish   714 TATDTFPAGTSVFISGWGATREGGSGATVLQKAEVRIINSTVCNQLMGGQITSRMTCAGVLSGGV 778

  Fly   226 DACQGDSGGPL-ICDGR---LAGIISWGVGCADPGYPGVYTNVSHFLKWIR 272
            ||||||||||| ...|:   |||::|||.|||....||:|:||..|..||:
Zfish   779 DACQGDSGGPLSFPSGKRMFLAGVVSWGDGCARRNKPGIYSNVPKFRAWIK 829

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 88/243 (36%)
Tryp_SPc 38..273 CDD:238113 90/245 (37%)
st14aNP_001035441.2 SEA 77..168 CDD:279699
CUB 219..322 CDD:238001
CUB 329..431 CDD:238001
LDLa 443..472 CDD:238060
LDLa 474..508 CDD:238060
LDLa 510..544 CDD:238060
LDLa 550..585 CDD:238060
Tryp_SPc 596..828 CDD:214473 88/243 (36%)
Tryp_SPc 597..831 CDD:238113 90/245 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.