DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and TMPRSS3

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_076927.1 Gene:TMPRSS3 / 64699 HGNCID:11877 Length:454 Species:Homo sapiens


Alignment Length:252 Identity:90/252 - (35%)
Similarity:130/252 - (51%) Gaps:40/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRD- 100
            :||||....:.|.|:|.|::.:..        |:|||:||:...:.:||||         || | 
Human   216 RIVGGNMSLLSQWPWQASLQFQGY--------HLCGGSVITPLWIITAAHC---------VY-DL 262

  Fly   101 --PELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIP 163
              |:.:.:..|  .:...|.....:||::||.|..|....|.|||||:.|.|.:.:..   ...|
Human   263 YLPKSWTIQVG--LVSLLDNPAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFNE---MIQP 322

  Fly   164 LAIKAPEE----GTTCLIHGWGKVTMKEKSAS--LQQAPVPILNKELC--QVIYK--LPASQMCA 218
            :.:...||    |..|...|||........||  |..|.||:::.::|  :.:|.  :..|.:||
Human   323 VCLPNSEENFPDGKVCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCA 387

  Fly   219 GFLQGGIDACQGDSGGPLICDGR----LAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            |:|.||:|:|||||||||:|..|    |.|..|:|:|||:...|||||.|:.||.||
Human   388 GYLTGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 88/250 (35%)
Tryp_SPc 38..273 CDD:238113 90/251 (36%)
TMPRSS3NP_076927.1 LDLa 74..107 CDD:238060
SRCR_2 112..210 CDD:292133
Tryp_SPc 216..444 CDD:214473 88/250 (35%)
Tryp_SPc 217..447 CDD:238113 90/251 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.