DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and PRSS56

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001356777.1 Gene:PRSS56 / 646960 HGNCID:39433 Length:604 Species:Homo sapiens


Alignment Length:280 Identity:92/280 - (32%)
Similarity:142/280 - (50%) Gaps:49/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :||||........|:.|.::        .|...:|||.:::...|.:||||: :.....|::.  
Human   104 RIVGGSAAPPGAWPWLVRLQ--------LGGQPLCGGVLVAASWVLTAAHCF-VGAPNELLWT-- 157

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWE--SPGVRAIPL 164
               |.:|..|..::    .:|..|.||:.|..::..|..||:||:.|     |.  |||..|.|:
Human   158 ---VTLAEGSRGEQ----AEEVPVNRILPHPKFDPRTFHNDLALVQL-----WTPVSPGGSARPV 210

  Fly   165 AI----KAPEEGTTCLIHGWGKVTMKEKSA-SLQQAPVPILNKELCQVIY---KLPASQMCAGFL 221
            .:    :.|..||.|.|.|||.:......| ::::|.||:|:.:.|:...   ..|::.:|||:|
Human   211 CLPQEPQEPPAGTACAIAGWGALFEDGPEAEAVREARVPLLSTDTCRRALGPGLRPSTMLCAGYL 275

  Fly   222 QGGIDACQGDSGGPLICDGR-------LAGIISWGVGCADPGYPGVYTNVSHFLKWIRR----AN 275
            .||:|:|||||||||.|...       |.|:.|||.||.:||.|||||.|:.|..|::.    |:
Human   276 AGGVDSCQGDSGGPLTCSEPGPRPREVLFGVTSWGDGCGEPGKPGVYTRVAVFKDWLQEQMSAAS 340

  Fly   276 ASLDYSEYRQI----PPLNL 291
            :|.:.| .|::    ||..|
Human   341 SSREPS-CRELLAWDPPQEL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 84/250 (34%)
Tryp_SPc 38..273 CDD:238113 85/251 (34%)
PRSS56NP_001356777.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..96
Tryp_SPc 105..335 CDD:238113 85/252 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..475
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.