DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and zgc:123295

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:298 Identity:95/298 - (31%)
Similarity:156/298 - (52%) Gaps:50/298 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCY--AINTSVPLVYR 99
            |||||........|:|||::..:     || ||.|||::|::..|.|||||:  :|.|       
Zfish    35 KIVGGQNAGAGSWPWQVSLQSPT-----YG-GHFCGGSLINKDWVLSAAHCFQDSIGT------- 86

  Fly   100 DPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPL 164
                .:|..|..:...::.:.....|.:::.|.:||..:.:|||||:.|:..:.:..   ...|:
Zfish    87 ----IMVKLGLQSQSGSNPYQITKTVVQVINHPNYNNPSNDNDIALVKLDSSVTFND---YIEPV 144

  Fly   165 AIKAP----EEGTTCLIHGWGKVTMKEKSAS------LQQAPVPILNKELCQVIY--KLPASQMC 217
            .:.|.    ..||...:.||||::    ||:      ||:..:||::...|:..|  ::.::.:|
Zfish   145 CLAAAGNTYAAGTLSWVTGWGKLS----SAANQIPDILQEVEIPIVSHSDCKRAYPGEITSNMIC 205

  Fly   218 AGFL-QGGIDACQGDSGGPLIC-DGR---LAGIISWGVGCADPGYPGVYTNVSHFLKWIRRANAS 277
            ||.| |||.|:||||||||::. :|.   .:||:|:|.|||:|||||||..||.:..||..:..|
Zfish   206 AGLLDQGGKDSCQGDSGGPMVSRNGSQWIQSGIVSFGRGCAEPGYPGVYARVSQYQDWITSSTGS 270

  Fly   278 LDYSEYRQIPPLNLASRRSVSSSCLGIGVLALAMSLRL 315
            .:       ||..:....|...|...:.:|:::::|.:
Zfish   271 SN-------PPGFVEFHSSGFRSTSNLFLLSISLTLSI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 86/252 (34%)
Tryp_SPc 38..273 CDD:238113 87/253 (34%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 86/252 (34%)
Tryp_SPc 36..264 CDD:238113 85/251 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.