DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG17242

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:255 Identity:69/255 - (27%)
Similarity:109/255 - (42%) Gaps:69/255 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVV 107
            ::.|:|.|:|.||:   |:::|:     |||.:.|:.::.:.|.|.                   
  Fly    21 SIGIEQAPWQASVQ---INDKHH-----CGGVIYSEDIILTIAECV------------------- 58

  Fly   108 AGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTL--------------ENDIAL------LFLNGFI 152
                   |..|.  |::..|:...::..|.|:              .:|:|:      |:|:|  
  Fly    59 -------RKARL--EFISVRVGSAQENAGGTVLKVEKMRLQVLGLRPSDVAILQLRSPLYLDG-- 112

  Fly   153 PWESPGVRAIPLAIKAPEEGTTCLIHGWGKVT-MKEKSASLQQAPVPILNKELCQVIYKLPASQM 216
                 |:||||||......||...:.|||::: |...|..|.:..|.|.::.:|.....|....|
  Fly   113 -----GIRAIPLATIPLVPGTNASVSGWGQLSAMNPSSEVLLRVDVKIQDQLMCATNLALKGRLM 172

  Fly   217 CAGFL----QGGID-ACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            ..|.:    .|.|. ||||..||||:.:.||.||:||...|.......||.|::.|..||
  Fly   173 SVGEICAAPAGEIPYACQGFVGGPLVANNRLYGILSWQSACDVLNKSSVYANIAMFKVWI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 67/253 (26%)
Tryp_SPc 38..273 CDD:238113 69/255 (27%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 69/252 (27%)
Tryp_SPc 24..232 CDD:214473 67/250 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.