DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG17239

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:254 Identity:93/254 - (36%)
Similarity:128/254 - (50%) Gaps:36/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHV-CGGAVISQRVVCSAAHCYAINTSVPLVYRD 100
            :||||..:||..||:|.|:.|         ||.. ||.|:.|:.:|.:||||        |..|:
  Fly    23 RIVGGDLITILSVPWQASILR---------LGRFHCGAAIYSEDIVITAAHC--------LTDRE 70

  Fly   101 PELYVVVAGSSAIDRTDRFT----QEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRA 161
            .|...|..|||       ||    |...|..::.|::|:.| ..||||::.|...:...| .|..
  Fly    71 TEFLSVRVGSS-------FTFFGGQVVRVSSVLLHEEYDQS-WSNDIAVMRLQSKLRLGS-AVSV 126

  Fly   162 IPLAIKAPEEGTTCLIHGWGKVTMKEK-SASLQQAPVPILNKELCQVIY--KLPASQMCAGFLQG 223
            ||||...|..|:...:.|||.:..|:. ..|:..|.|.|::::.|:..|  |:....:||.  ..
  Fly   127 IPLADTPPASGSPATVSGWGAIGFKKNYPMSILSASVDIVDQDQCRRSYGRKITKDMICAA--AP 189

  Fly   224 GIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWIRRANASLDYSE 282
            |.|||.|||||||:...:|.||:|:|..||.|.|||||.||:....||..|...:..||
  Fly   190 GKDACSGDSGGPLVSGNKLVGIVSFGKECAHPEYPGVYANVAELKPWILGAIERITKSE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 88/241 (37%)
Tryp_SPc 38..273 CDD:238113 90/242 (37%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 88/241 (37%)
Tryp_SPc 24..237 CDD:238113 88/240 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.