DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and F12

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_067464.2 Gene:F12 / 58992 MGIID:1891012 Length:597 Species:Mus musculus


Alignment Length:268 Identity:88/268 - (32%)
Similarity:128/268 - (47%) Gaps:51/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            ::|||........|:..::         |...:.|.|::|:...|.:||||.....:       |
Mouse   354 RVVGGLVALPGSHPYIAAL---------YWGNNFCAGSLIAPCWVLTAAHCLQNRPA-------P 402

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWE---------SP 157
            |...||.|....:::..:.|...|:....|:.::..|.::|:|||.|.     |         ||
Mouse   403 EELTVVLGQDRHNQSCEWCQTLAVRSYRLHEGFSSITYQHDLALLRLQ-----ESKTNSCAILSP 462

  Fly   158 GVR--AIPLAIKAPEEGTTCLIHGWGK--VTMKEKSASLQQAPVPILNKELC-------QVIYKL 211
            .|:  .:|.....|.|...|.:.|||.  ...:|.|..||:|.||.:..:.|       ..|  |
Mouse   463 HVQPVCLPSGAAPPSETVLCEVAGWGHQFEGAEEYSTFLQEAQVPFIALDRCSNSNVHGDAI--L 525

  Fly   212 PASQMCAGFLQGGIDACQGDSGGPLICDG-------RLAGIISWGVGCADPGYPGVYTNVSHFLK 269
            | ..:|||||:||.|||||||||||:|:.       .|.|:||||.||.|...|||||:|:::|.
Mouse   526 P-GMLCAGFLEGGTDACQGDSGGPLVCEEGTAEHQLTLRGVISWGSGCGDRNKPGVYTDVANYLA 589

  Fly   270 WIRRANAS 277
            ||::..||
Mouse   590 WIQKHIAS 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 84/260 (32%)
Tryp_SPc 38..273 CDD:238113 86/261 (33%)
F12NP_067464.2 FN2 41..88 CDD:238019
EGF_CA 96..131 CDD:238011
FN1 133..173 CDD:238018
EGF 178..206 CDD:278437
KR 217..295 CDD:294073
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..338
Tryp_SPc 354..591 CDD:214473 84/260 (32%)
Tryp_SPc 355..594 CDD:238113 86/262 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.