DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Prss21

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_065233.2 Gene:Prss21 / 57256 MGIID:1916698 Length:324 Species:Mus musculus


Alignment Length:310 Identity:98/310 - (31%)
Similarity:141/310 - (45%) Gaps:74/310 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLIVATHSGITQS----------QIGQPTATASPF---VILPKIVGGYTVTIDQVPFQVSVRRRS 59
            |::|||.:...||          ::.:|...:.|.   .|..:||||....:.:.|:|.|:    
Mouse    12 LVVVATAAMALQSTYLQVDPEKPELQEPDLLSGPCGHRTIPSRIVGGDDAELGRWPWQGSL---- 72

  Fly    60 IHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDR------ 118
               |.:| .|:||..::::|.|.:||||:..:       .||..:.|..|    :.|.|      
Mouse    73 ---RVWG-NHLCGATLLNRRWVLTAAHCFQKD-------NDPFDWTVQFG----ELTSRPSLWNL 122

  Fly   119 --FTQEYLVQRIVGHKDYNGSTLENDIALLFL------NGFIPWESPGVRAIPLAIKAP----EE 171
              ::..|.::.|.....|: ....||||||.|      |.||.         |:.:...    |.
Mouse   123 QAYSNRYQIEDIFLSPKYS-EQYPNDIALLKLSSPVTYNNFIQ---------PICLLNSTYKFEN 177

  Fly   172 GTTCLIHGWGKVTMKEKSAS---LQQAPVPILNKELCQVIYKLP-------ASQMCAGFLQGGID 226
            .|.|.:.|||.:...|...|   ||:..|.|:|..:|..:||.|       ...:|||..:||.|
Mouse   178 RTDCWVTGWGAIGEDESLPSPNTLQEVQVAIINNSMCNHMYKKPDFRTNIWGDMVCAGTPEGGKD 242

  Fly   227 ACQGDSGGPLICDGRL----AGIISWGVGCADPGYPGVYTNVSHFLKWIR 272
            ||.|||||||.||...    .|::|||:||..|..||||||:||...||:
Mouse   243 ACFGDSGGPLACDQDTVWYQVGVVSWGIGCGRPNRPGVYTNISHHYNWIQ 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 87/265 (33%)
Tryp_SPc 38..273 CDD:238113 89/267 (33%)
Prss21NP_065233.2 Tryp_SPc 54..291 CDD:214473 87/265 (33%)
Tryp_SPc 55..294 CDD:238113 89/267 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.